DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap9

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_012813282.2 Gene:arhgap9 / 100494875 XenbaseID:XB-GENE-1013568 Length:789 Species:Xenopus tropicalis


Alignment Length:209 Identity:66/209 - (31%)
Similarity:106/209 - (50%) Gaps:19/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDRE------ 359
            |||..|..:...| :..:|..|..|:|.|..||:..:|||||:|....|:.|:..:|||      
 Frog   572 VFGCRLDALCHRE-NSTVPKFVCMCIEAVNERGLEADGIYRVNGNLATIQKLRFIVDRERAVTTD 635

  Fly   360 -----------GEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQR 413
                       .||.|:|.:.:.:|:||.|.||::.|.||.|||.|..:..::.|.:.....|:.
 Frog   636 GRYLFPEQLSQEEKLDLSTSDWEDVHVITGALKMFFRELPEPLIPFSMFEQYVEAVQIPDLDERI 700

  Fly   414 QLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHM-TNLTEEI 477
            :.:.:.|..||..:|..|::||.|||||..|...|:|...|:..||.|||:...:.: :|:...:
 Frog   701 ETIKDLVSTLPEPNHDTLKHMLSHLKRVMEHSETNRMTTQNIGIVFGPTLMRPEKELFSNIAANM 765

  Fly   478 FMLSSLITHCKTIF 491
            ...:.::.|..|.:
 Frog   766 VYQNQVVEHFLTYY 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 65/206 (32%)
arhgap9XP_012813282.2 SH3 33..80 CDD:418401
WW 215..243 CDD:395320
PH_ARHGAP9-like 379..490 CDD:270053
RhoGAP_ARHGAP27_15_12_9 573..777 CDD:239868 64/204 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.