DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap31

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_031752308.1 Gene:arhgap31 / 100489741 XenbaseID:XB-GENE-6467299 Length:1410 Species:Xenopus tropicalis


Alignment Length:203 Identity:60/203 - (29%)
Similarity:103/203 - (50%) Gaps:14/203 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 GVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTD 364
            |.||.|||..:: .....:|.|::.|.|.:|..|:: :||||:||....|:.|:.....: :..|
 Frog    17 GAFGCDLTEYLE-NSGQDVPHVLKSCAEFIETHGVV-DGIYRLSGVTSNIQKLRQEFGSD-QPPD 78

  Fly   365 MSETAY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHH 428
            :|...| .:::.:....|||.|.||.||:|:|.|..|..|.......::...:.|.::.|||.|:
 Frog    79 LSRDVYLQDIHCVGSLCKLYFRELPNPLLTYQLYSKFTDAVSCSVDGDKLSQILEVIQELPPTHY 143

  Fly   429 SCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ----------HMTNLTEEIFMLSSL 483
            ..|:|:.:||..:|||.:...|:..|||.|:||.|:.:.:          ....:..:.|::..:
 Frog   144 RTLEYLSKHLTHIASHSSTTNMHIRNLALVWAPNLLRSKEIEDAGCNGDAAFMEVRVQQFVIEFI 208

  Fly   484 ITHCKTIF 491
            :.|...||
 Frog   209 LNHVDQIF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 57/199 (29%)
arhgap31XP_031752308.1 RhoGAP_CdGAP 18..211 CDD:239849 56/195 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.