DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap26

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_012814023.2 Gene:arhgap26 / 100145296 XenbaseID:XB-GENE-1011980 Length:771 Species:Xenopus tropicalis


Alignment Length:567 Identity:116/567 - (20%)
Similarity:203/567 - (35%) Gaps:191/567 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RCQRTLPLPPAKSTAEAVEANNLAGRLYGSEYHGLMGHLEAEQLLANARDGSYFVR-----RSPQ 111
            ||     :..|::..|...|.:|      .|:..::|:||.|::......|...:.     |..|
 Frog    70 RC-----IGDAETDDEICIARSL------QEFAAVLGNLEDERIRMIDNSGEVLISPLEKFRKEQ 123

  Fly   112 SDGYYTLSLRFNKR--------PKHYKL----------------------LYKPGVGHYLRGQD- 145
            ......:..:::|.        .||..|                      .|:..:.:.|:..: 
 Frog   124 VGAAKEVKKKYDKESEKYCAMLEKHMNLSSKKKEVLLHEADVQLDQMRQHFYEVSLEYVLKVHEV 188

  Fly   146 ---KRFDTVHDMVA--DGLINFHMQLHASPIIQQIN----------QQTKNCYQQSPYMTLNGRK 195
               |.|:.|..::|  .||..|:.  |...:.:..:          |.|::             :
 Frog   189 QERKMFEFVEPLLAFLQGLFTFYH--HGYELAKDFSDFKTQLSISIQNTRD-------------R 238

  Fly   196 LRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPL-----VYEKPHHFKVHTFKGLNWC 255
            .....:|: ::..|:.||:|.|..          |:.|..:     |.||.|.       |.:|.
 Frog   239 FEGTRSEV-ESLMKKMKENPHEHL----------ALSPYTMEGYLYVQEKRHF-------GTSWV 285

  Fly   256 EFCANFLWGFTAQGVKCEACGFVAHSKCSELVP-----------------PKCVPDL-----KR- 297
            :                ..|.:...:|...:||                 ..|:...     || 
 Frog   286 K----------------HYCTYQRETKQMTMVPFDQKSGGKVGEEEIIHLKSCIRRKTESIEKRF 334

  Fly   298 ---IRGVFGTDLTTMVQL---------------EPHH---------------QIPF-VVRRCVEE 328
               :.||....:.||..|               ||.:               .|.| ::|:|::.
 Frog   335 CFDVEGVDRPTVLTMQALSEEDRKLWMEAMDGREPVYNSNKDSQSEGTAQLDNIGFSIIRKCIQA 399

  Fly   329 VEARGMLQEGIYRVSGFADEIE-ALKLALD-REGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPL 391
            ||.||:.::|:||:.|....:: .|...:| :...:|:....:...:..|..:||.|||:||.||
 Frog   400 VETRGINEQGLYRIVGVNSRVQKLLNFLMDPKISPETETEIPSEWEIKTITSSLKTYLRMLPGPL 464

  Fly   392 ITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLA 456
            :|:|...||:.|.:...|..:.:.:...:.|||..:...|..::.||..||:|:..|.|...||.
 Frog   465 MTYQFQRSFIKAAKLENQESRIKEIHCLIHRLPEKNRQMLNLLMTHLANVAAHHKQNLMTVANLG 529

  Fly   457 TVFAPTLIATPQHMT----------NLTEEIFMLSSLITHCKTIFAT 493
            .||.|||: .||..|          |:..||     :|.:.:.:|:|
 Frog   530 IVFGPTLL-RPQEETVAAIMDIKFQNIVVEI-----IIENYEKMFST 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 21/131 (16%)
C1_1 242..294 CDD:278556 8/68 (12%)
RhoGAP_chimaerin 302..491 CDD:239837 61/231 (26%)
arhgap26XP_012814023.2 BAR_GRAF 19..225 CDD:153320 28/167 (17%)
BAR-PH_GRAF_family 267..371 CDD:269953 20/126 (16%)
RhoGAP_Graf 364..563 CDD:239839 58/204 (28%)
SH3_GRAF 716..771 CDD:212997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.