DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap33

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_031760545.1 Gene:arhgap33 / 100037855 XenbaseID:XB-GENE-852586 Length:1280 Species:Xenopus tropicalis


Alignment Length:410 Identity:99/410 - (24%)
Similarity:173/410 - (42%) Gaps:78/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DKRFDTVHDMVADGLINFHMQLHASPIIQQ-------INQQTKNCYQQSPYMTLNGRKLRALSNE 202
            |:||..:.::.....:....||.| |::.:       |.....||.....:|.::....|.|.||
 Frog   132 DRRFSQLLELPPRSELPAQGQLLA-PLLSRYLKGLTGIVDSNINCGPILNWMEIDNHGNRLLVNE 195

  Fly   203 LGK------AAAKESKESPAEEKEQKQEE--------PPPPAVDPMPLVYEKPHHFKVHTFKGLN 253
            ...      |||...|...|:..::...|        ..||..|..  .:...|.|:|..|.   
 Frog   196 EASINVPAIAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPREDTS--WWRGKHSFQVGFFP--- 255

  Fly   254 WCEFCANFLWGF-----TAQG-VK---------------CEACGFVAHSKCSELVPPKCV--PDL 295
              ..|...:...     |.:| ||               |.     .|.|.:.|:.....  |..
 Frog   256 --SECVQLITDSKSPSPTGEGDVKLPITPPHGSNSPRPVCR-----RHGKLAGLLRSFMASRPSK 313

  Fly   296 KRIR-------GVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALK 353
            :|:|       .||||||...: |....::|.|:..|.:.:|..|:: :||||:||.:..|:.|:
 Frog   314 QRLRQRGILRERVFGTDLGEHL-LNSGEEVPRVLLCCAQFIEKFGVV-DGIYRLSGVSSNIQKLR 376

  Fly   354 LALDREGEKTDMS-ETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMA 417
            ...|.| ...|:| :|...:|:.::...|||.|.||.||:|::.|..|..|.....:.::...:.
 Frog   377 HEFDSE-RIPDLSRDTFLQDVHCVSSLCKLYFRELPNPLLTYRLYQPFTEAMSAATEEDKLIRVH 440

  Fly   418 EAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTL--------IATP--QHMTN 472
            :.:::|||.|:..|:|:::||.::::|.....|:..|||.::||.|        :.||  .....
 Frog   441 DLIQQLPPPHYRTLEYLMKHLSQLSTHSDRTGMHARNLAIIWAPNLLRSRDMESVGTPGADAFRE 505

  Fly   473 LTEEIFMLSSLITHCKTIFA 492
            :..:..::..|:.:.:|:|:
 Frog   506 VRVQSVLVEFLLCNVETLFS 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 3/20 (15%)
C1_1 242..294 CDD:278556 13/74 (18%)
RhoGAP_chimaerin 302..491 CDD:239837 57/199 (29%)
arhgap33XP_031760545.1 PX_TCGAP 72..184 CDD:132832 11/52 (21%)
SH3_ARHGAP32_33 206..259 CDD:212769 12/59 (20%)
RhoGAP_CdGAP 325..517 CDD:239849 56/194 (29%)
PHA03247 <719..1056 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.