DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and myo9aa

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021333664.1 Gene:myo9aa / 100006612 ZFINID:ZDB-GENE-080424-5 Length:2590 Species:Danio rerio


Alignment Length:366 Identity:94/366 - (25%)
Similarity:164/366 - (44%) Gaps:68/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QDKRFDTVHDMV----------------------ADGLINFHMQLHA--SPIIQQINQQTKNCYQ 184
            :|.:.||:.|:|                      .||....:..|:|  ..|:::..:|.:..:.
Zfish  1917 EDGKKDTMVDVVFKKALKEFRVNIFNSYSTALAMDDGKSIRYKDLYALFEQILEKNMRQEQRDWS 1981

  Fly   185 QSP--------------YMTLNGRKLRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMP 235
            :||              :||    :.:.|.:.||||...:.|:...::.:..:|           
Zfish  1982 ESPVKVWVNTFKVFLDEFMT----EHKPLDSSLGKAPKPDRKKRRKKDTDVVEE----------- 2031

  Fly   236 LVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCV----PDLK 296
               ...|.||...:....:||:|::.:| ...:...|:.|.:..|.||.:.:..||.    |:|.
Zfish  2032 ---HNGHIFKSTQYSIPTYCEYCSSLIW-MMDKACVCKLCRYACHRKCCQKMTTKCSKKYDPELS 2092

  Fly   297 RIRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGE 361
            ..:  ||.:|:.:...|  ..:|.||.:.|..:|..|:..|||||.||..::|:.||..||.:..
Zfish  2093 SRQ--FGVELSRLTNDE--RTVPLVVEKLVNYIEMHGLYTEGIYRKSGSTNKIKELKQGLDTDVN 2153

  Fly   362 KTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPA 426
            ..::.:.   |:||||...|.:||.||.||:||:.|..|:.|.....:.|..:.:...:.:|...
Zfish  2154 GVNLDDY---NINVIASVFKQWLRDLPNPLMTFELYEEFLRAMGLQDKKEVIRGVYSVIDQLSRT 2215

  Fly   427 HHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATP 467
            |.:.|:.::.||.|:|.....|:|:.:.||.||||.::..|
Zfish  2216 HLNTLERLIFHLVRIALQEETNRMSANALAIVFAPCILRCP 2256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 7/43 (16%)
C1_1 242..294 CDD:278556 14/55 (25%)
RhoGAP_chimaerin 302..491 CDD:239837 56/166 (34%)
myo9aaXP_021333664.1 UBQ 7..111 CDD:320785
MYSc_Myo9 161..1039 CDD:276836
IQ 1145..1166 CDD:197470
Activator_LAG-3 <1464..1574 CDD:331748
C1_1 2035..2083 CDD:278556 12/48 (25%)
RhoGAP 2096..2281 CDD:295372 56/166 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.