DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap35a

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_001343636.1 Gene:arhgap35a / 100004299 ZFINID:ZDB-GENE-120516-2 Length:1536 Species:Danio rerio


Alignment Length:205 Identity:57/205 - (27%)
Similarity:95/205 - (46%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 FGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGE----K 362
            ||..|..:|  .|...||..:.:|:..:|..|:..||||||||...|:|:::...|::..    :
Zfish  1266 FGVPLANVV--TPERPIPLFIEKCIHYIETTGLSTEGIYRVSGNKAEMESMQRQFDQDPNIDLVE 1328

  Fly   363 TDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAH 427
            .|||      ||.:||.||.:...||.||:.:......:.|.:...:..:...|.:.:||.|..:
Zfish  1329 KDMS------VNTVAGALKSFFSELPDPLVPYSMQVELVEAFKINDREHRLHTMKDVLRRFPREN 1387

  Fly   428 HSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-----------ATPQHMTNLTEEIFMLS 481
            :...:|::.||.:|:.:..:|.|...||:..|.|||:           ||..:.|       ::.
Zfish  1388 YDVFKYVITHLNKVSLNSRLNLMTSENLSICFWPTLMRPDFTTMDALTATRTYQT-------IIE 1445

  Fly   482 SLITHCKTIF 491
            :.|..|...|
Zfish  1446 TFIHQCAFFF 1455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 56/203 (28%)
arhgap35aXP_001343636.1 RAB 29..247 CDD:197555
Ras_like_GTPase 29..245 CDD:206648
RhoGAP-FF1 261..340 CDD:293121
FF 431..482 CDD:128718
RhoGAP_p190 1266..1450 CDD:239838 55/198 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.