Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001343636.1 | Gene: | arhgap35a / 100004299 | ZFINID: | ZDB-GENE-120516-2 | Length: | 1536 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 95/205 - (46%) | Gaps: | 30/205 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 FGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGE----K 362
Fly 363 TDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAH 427
Fly 428 HSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-----------ATPQHMTNLTEEIFMLS 481
Fly 482 SLITHCKTIF 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | |||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 56/203 (28%) | ||
arhgap35a | XP_001343636.1 | RAB | 29..247 | CDD:197555 | |
Ras_like_GTPase | 29..245 | CDD:206648 | |||
RhoGAP-FF1 | 261..340 | CDD:293121 | |||
FF | 431..482 | CDD:128718 | |||
RhoGAP_p190 | 1266..1450 | CDD:239838 | 55/198 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |