DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and myl6

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_005166134.1 Gene:myl6 / 798632 ZFINID:ZDB-GENE-041010-28 Length:164 Species:Danio rerio


Alignment Length:175 Identity:48/175 - (27%)
Similarity:81/175 - (46%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDV-ADCLRIMGLNPSDDELQQRLE 91
            :|.:.:..|.||     |:...|: :....|.|:...:....| |:.|:::| |||:::      
Zfish     8 QICEFKEAFLLF-----DRTGDGK-IMYNQCGDVMRALGQNPVNAEVLKVLG-NPSNED------ 59

  Fly    92 EHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGMLP 156
                      |.||.:    .||..|.:...:|    |...:|.. |:.:..||..|..|.|.:.
Zfish    60 ----------MNMKML----DFEQFLPMLQAIA----KNKDQGSF-EDFVEGLRVFDKEGNGTVM 105

  Fly   157 YSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYE-HLVHQLF 200
            .::|||:|||:|.::.|.||..:|....|.||.:.|| .:.|::|
Zfish   106 GAELRHVLTTLGEKMTEEEVETLLAGHEDANGCINYEGTITHKVF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 48/175 (27%)
FRQ1 <188..297 CDD:227455 5/14 (36%)
myl6XP_005166134.1 EFh 11..94 CDD:298682 24/114 (21%)
EF-hand_6 11..40 CDD:290141 7/34 (21%)
EFh 88..142 CDD:238008 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.