DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl4

DIOPT Version :10

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:179 Identity:45/179 - (25%)
Similarity:73/179 - (40%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDDELQQRL-- 90
            :|.:.:..|.||     |:...||           :.|......|.||.:|.||::.|:.:.|  
  Rat    48 QIEEFKEAFSLF-----DRTPTGE-----------MKITYGQCGDVLRALGQNPTNAEVLRVLGK 96

  Fly    91 ---EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGT 152
               ||         |..|.:    .||:.|.:.     |.:....:....|:.:..||..|....
  Rat    97 PKPEE---------MNSKTL----DFEMFLPIL-----QHISRNKEQGTYEDFVEGLRVFDKESN 143

  Fly   153 GMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFA 201
            |.:..::|||:|.|:|.::.|.||..:|....|.||.:.||..|..:.:
  Rat   144 GTVMGAELRHVLATLGEKMSEAEVEQLLTGQEDANGCINYEAFVKHVMS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 PTZ00184 <74..196 CDD:185504 35/126 (28%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 45/177 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.