DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl1

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_038940068.1 Gene:Myl1 / 56781 RGDID:1598796 Length:232 Species:Rattus norvegicus


Alignment Length:179 Identity:50/179 - (27%)
Similarity:77/179 - (43%) Gaps:44/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LMRMLPEI-PKLRNIFDLF-VVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDD 84
            |:..|||: .:.:..|.|| ...||.                   |.::.|.|.||.:|.||::.
  Rat    62 LLFCLPELHHEFKEAFLLFDRTGECK-------------------ITLSQVGDVLRALGTNPTNA 107

  Fly    85 ELQQRL-----EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVL 144
            |:::.|     ||         |..|||    .||..|.:...::..  |:...   .|:.:..|
  Rat   108 EVKKVLGNPSNEE---------MNAKKI----EFEQFLPMMQAISNN--KDQGG---YEDFVEGL 154

  Fly   145 RSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYE 193
            |..|..|.|.:..::|||:|.|:|.::.|.||..:|....|.||.:.||
  Rat   155 RVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 50/179 (28%)
FRQ1 <188..297 CDD:227455 3/6 (50%)
Myl1XP_038940068.1 PTZ00184 72..203 CDD:185504 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.