DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and MYL3

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens


Alignment Length:175 Identity:47/175 - (26%)
Similarity:74/175 - (42%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDDELQQRLEE 92
            :|.:.:..|.||     |:        .|.|   .:.|......|.||.:|.||:..|:.:.|.:
Human    50 QIEEFKEAFMLF-----DR--------TPKC---EMKITYGQCGDVLRALGQNPTQAEVLRVLGK 98

  Fly    93 HVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPY 157
              .|:|.|...|      ..||..|.:.     |.:.:.......|:.:..||..|..|.|.:..
Human    99 --PRQEELNTKM------MDFETFLPML-----QHISKNKDTGTYEDFVEGLRVFDKEGNGTVMG 150

  Fly   158 SQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFAT 202
            ::|||:|.|:|.||.|.||..::....|.||.:.||..|..:.::
Human   151 AELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 47/175 (27%)
FRQ1 <188..297 CDD:227455 4/15 (27%)
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 47/172 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.