DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34435 and MYL1

DIOPT Version :9

Sequence 1:	NP_572233.2	Gene:	CG34435 / 31471	FlyBaseID:	FBgn0085464	Length:	299	Species:	Drosophila melanogaster
Sequence 2:	NP_524144.1	Gene:	MYL1 / 4632	HGNCID:	7582	Length:	194	Species:	Homo sapiens

Alignment Length:	143	Identity:	40/143 - (27%)
Similarity:	64/143 - (44%)	Gaps:	25/143 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    65 IRMTDVADCLRIMGLNPSDDELQQRLEEHVRRRESLG------MGMKKIAQRATFELVLTLYCQL 123
            |.::.|.|.||.:|.||::.|:          |:.||      :..|||    .||..|.:.
Human    70 ITLSQVGDVLRALGTNPTNAEV----------RKVLGNPSNEELNAKKI----EFEQFLPMM--- 117

  Fly   124 AEQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADING 188
              |.:.........|:.:..||..|..|.|.:..::|||:|.|:|.::.|.||..::....|.||
Human   118 --QAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNG 180

  Fly   189 NVLYEHLVHQLFA 201
            .:.||..|..:.:
Human   181 CINYEAFVKHIMS 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34435	NP_572233.2	FRQ1	17..205	CDD:227455	40/143 (28%)
CG34435	NP_572233.2	FRQ1	<188..297	CDD:227455	4/14 (29%)
MYL1	NP_524144.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..35
		PTZ00184	45..193	CDD:185504	40/141 (28%)
		EFh	54..118	CDD:298682	18/66 (27%)
		EF-hand_6	54..83	CDD:290141	5/12 (42%)
		EFh	131..192	CDD:238008	20/60 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0030
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23048
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.910