DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and myl3

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_989012.1 Gene:myl3 / 394608 XenbaseID:XB-GENE-946570 Length:188 Species:Xenopus tropicalis


Alignment Length:180 Identity:44/180 - (24%)
Similarity:72/180 - (40%) Gaps:41/180 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLF-VVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDDELQQRLE 91
            :|.:.:..|.|| ...:|:|.                 |......|.||.:|.||::.|:     
 Frog    43 QIEEFKEAFSLFDRTPKCEQK-----------------ITYGQCGDVLRALGQNPTNAEV----- 85

  Fly    92 EHVRRRESLGMGMKKIAQRATFELVLTL-----YCQLAEQEVKEMAKGCIVENVLRVLRSRDSAG 151
                        :|.:.:....||.|.|     :..:.:...|...|| ..|:.:..||..|..|
 Frog    86 ------------LKVLGKPKAEELSLKLMDFDTFLPMLQHISKSKEKG-TYEDFVEGLRVFDKEG 137

  Fly   152 TGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFA 201
            .|.:..:::||:|.|:|.|:.|.||..:|....|.||::.||.....:.|
 Frog   138 NGTVMGAEIRHVLATLGERMTEEEVDRLLQGQEDPNGHINYEAFAKYILA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 44/180 (24%)
FRQ1 <188..297 CDD:227455 4/14 (29%)
myl3NP_989012.1 PTZ00184 37..188 CDD:185504 44/180 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.