DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl6l

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001094453.2 Gene:Myl6l / 362816 RGDID:1305620 Length:151 Species:Rattus norvegicus


Alignment Length:182 Identity:43/182 - (23%)
Similarity:77/182 - (42%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 CQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVL--HRA 183
            |...|.:..|..:         ..:..|..|.|.:.|||...::..:|......||..||  .::
  Rat     2 CDFTEDQTAEFKE---------AFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKS 57

  Fly   184 ADINGNVL-YEHLVHQLFATDPLAEERLQQAQLYLQAVGRNAIDMDMDKRDEFIDAIRRADPARS 247
            .::|..|| :||.:       |:           ||.|.:|   .|....:::::.:|..|...:
  Rat    58 DEMNVKVLDFEHFL-------PM-----------LQTVAKN---KDQGTYEDYVEGLRVFDKEGN 101

  Fly   248 GFIEPQRLLELLNRNGEQFTGEELQLLIQGMEDTR-CKRGINYCRFLEFIMN 298
            |.:....:..:|...||:.|.||:::|:.|.||:. |   |||...:..::|
  Rat   102 GTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGC---INYEELVRMVLN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 19/86 (22%)
FRQ1 <188..297 CDD:227455 27/110 (25%)
Myl6lNP_001094453.2 PTZ00184 5..149 CDD:185504 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.