DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and myl1

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_956294.1 Gene:myl1 / 336165 ZFINID:ZDB-GENE-030131-8109 Length:190 Species:Danio rerio


Alignment Length:142 Identity:34/142 - (23%)
Similarity:62/142 - (43%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IRMTDVADCLRIMGLNPSDDELQQRL-----EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLA 124
            :....:||.:|.:|.||::.|:.:.|     ::.|.:             |..||..|.:.    
Zfish    66 VAYNQIADIMRALGQNPTNKEVTKILGNPTADDMVNK-------------RVDFEGFLPML---- 113

  Fly   125 EQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGN 189
             |.|.........::.:..||..|..|.|.:..::||.:|:|:|.::.|.|:..::....|.||.
Zfish   114 -QVVINNPNKATYDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMSEAEIDALMQGQEDENGC 177

  Fly   190 VLYEHLVHQLFA 201
            |.||..|..:.:
Zfish   178 VNYEAFVKHIMS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 34/142 (24%)
FRQ1 <188..297 CDD:227455 5/14 (36%)
myl1NP_956294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
FRQ1 43..189 CDD:227455 34/140 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.