DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Mlc-c

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster


Alignment Length:173 Identity:43/173 - (24%)
Similarity:80/173 - (46%) Gaps:35/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLRIMGLNPSDDELQQRLEEH 93
            :.:.:..|:||     |....|:             |:::.|.:|||.:|.||::.::::...: 
  Fly    15 LEEFQEAFNLF-----DNRGDGK-------------IQLSQVGECLRALGQNPTESDVKKCTHQ- 60

  Fly    94 VRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPYS 158
                       .|..:|.:||:.|.:|     |.:.:...|...::.:..||..|...:|.:..:
  Fly    61 -----------LKPDERISFEVFLPIY-----QAISKARSGDTADDFIEGLRHFDKDASGYISSA 109

  Fly   159 QLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFA 201
            :|||||||:|.:|.:.||..:|....|..||:.||..|..:.:
  Fly   110 ELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYEEFVRMVMS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 43/173 (25%)
FRQ1 <188..297 CDD:227455 5/14 (36%)
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 43/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.