DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and cdc4

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_594947.1 Gene:cdc4 / 2541699 PomBaseID:SPAP8A3.08 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:40/152 - (26%)
Similarity:66/152 - (43%) Gaps:30/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFATDPLAEERLQQ 212
            |..|||.:|.:.:..||...|......|                    :.::.:|.| ||..::|
pombe    16 DRHGTGRIPKTSIGDLLRACGQNPTLAE--------------------ITEIESTLP-AEVDMEQ 59

  Fly   213 AQLYLQAVGR-NAIDMDMDKRDEFIDAIRRADPARSGFIEPQRLLELLNRNGEQFTGEELQLLIQ 276
               :||.:.| |..||..|. :||:...:..|...:|.|....|..:|...||:.:.||:..|::
pombe    60 ---FLQVLNRPNGFDMPGDP-EEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLK 120

  Fly   277 GMEDTRCKRG-INYCRFLEFIM 297
            |:.   .|.| :||..|::.|:
pombe   121 GVP---VKDGMVNYHDFVQMIL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 10/56 (18%)
FRQ1 <188..297 CDD:227455 30/110 (27%)
cdc4NP_594947.1 PTZ00184 8..141 CDD:185504 40/152 (26%)
EF-hand_6 8..36 CDD:290141 7/19 (37%)
EFh 78..138 CDD:238008 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.