DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl3

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_036738.1 Gene:Myl3 / 24585 RGDID:3142 Length:200 Species:Rattus norvegicus


Alignment Length:192 Identity:51/192 - (26%)
Similarity:80/192 - (41%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KQSEL------MRMLPE-IPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDLGIGIRMTDVADCLR 75
            |::|.      :...|| |.:.:..|.||     |:...||           :.|......|.||
  Rat    38 KEAEFDASKIKIEFTPEQIEEFKEAFQLF-----DRTPKGE-----------MKITYGQCGDVLR 86

  Fly    76 IMGLNPSDDELQQRLEEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENV 140
            .:|.||:..|:.:.|.:  .::|.|...|      ..||..|.:.     |.:.:.......|:.
  Rat    87 ALGQNPTQAEVLRVLGK--PKQEELNSKM------MDFETFLPML-----QHISKNKDTGTYEDF 138

  Fly   141 LRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFAT 202
            :..||..|..|.|.:..::|||:|.|:|.||.|.||..::....|.||.:.||..|..:.|:
  Rat   139 VEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMAS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 51/192 (27%)
FRQ1 <188..297 CDD:227455 5/15 (33%)
Myl3NP_036738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 1/3 (33%)
PTZ00184 49..199 CDD:185504 48/178 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.