DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl6b

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:176 Identity:50/176 - (28%)
Similarity:81/176 - (46%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDL--GIGIRMTDVADCLRIMGLNPSDDELQQRL 90
            ::.:.|..|:||     |:...|: :....|.||  .:|...|: |:.|:::| ||.::||:.| 
Mouse    64 QLEEFREAFELF-----DRVGDGK-ILYSQCGDLMRALGQNPTN-AEVLKVLG-NPKNEELKSR- 119

  Fly    91 EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGML 155
                               |..||..|.:...:|    |...:| ..|:.|..||..|..|.|.:
Mouse   120 -------------------RVDFETFLPMLQAVA----KNRDQG-TYEDYLEGLRVFDKEGNGKV 160

  Fly   156 PYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFA 201
            ..::|||:|||:|.::.|.||..||....|.||.:.||..:..:.:
Mouse   161 MGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 50/176 (28%)
FRQ1 <188..297 CDD:227455 3/14 (21%)
Myl6bNP_758463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PTZ00184 57..206 CDD:185504 50/174 (29%)
EFh 67..131 CDD:298682 23/91 (25%)
EFh 67..95 CDD:197492 9/33 (27%)
EFh 150..204 CDD:238008 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.