DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and cal-7

DIOPT Version :9

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_505510.2 Gene:cal-7 / 185545 WormBaseID:WBGene00009585 Length:179 Species:Caenorhabditis elegans


Alignment Length:151 Identity:31/151 - (20%)
Similarity:59/151 - (39%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KEMAKGCIVENVLR----VLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGN 189
            ||.....|||::.|    |.:..|....|::....:.|:|.:.|....:||:..|..:.|..||.
 Worm    22 KEEVDSVIVEDIRRRLFDVFKMFDEDSDGLIETDDVSHVLRSFGLNPSQTELQLVSEQTAKKNGR 86

  Fly   190 VLYEHLVHQL---FATDPLAEERLQQAQLYLQAVGRNAIDMDMDKRDEFIDAIRRADPARSGFIE 251
            |.::.|:.::   ...:...::..:|.....|.:..|                        .:::
 Worm    87 VSFDDLLPRVVLAIQNEEWKDDTPKQIHAAFQVITSN------------------------NYVQ 127

  Fly   252 PQRLLELLNRNGEQFTGEELQ 272
            ...||:||...||..|.:|::
 Worm   128 KDTLLQLLTSIGEPLTPQEVK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 FRQ1 17..205 CDD:227455 20/82 (24%)
FRQ1 <188..297 CDD:227455 14/88 (16%)
cal-7NP_505510.2 PTZ00184 41..169 CDD:185504 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.