DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and Myl1

DIOPT Version :10

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_067260.1 Gene:Myl1 / 17901 MGIID:97269 Length:188 Species:Mus musculus


Alignment Length:142 Identity:42/142 - (29%)
Similarity:67/142 - (47%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IRMTDVADCLRIMGLNPSDDELQQRL-----EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLA 124
            |.::.|.|.||.:|.||::.|:::.|     ||         |..|||    .||..|.:...::
Mouse    64 ITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEE---------MNAKKI----EFEQFLPMMQAIS 115

  Fly   125 EQEVKEMAKGCIVENVLRVLRSRDSAGTGMLPYSQLRHLLTTMGNRLDETEVYGVLHRAADINGN 189
            ..  |:...   .|:.:..||..|..|.|.:..::|||:|.|:|.::.|.||..:|....|.||.
Mouse   116 NN--KDQGG---YEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGC 175

  Fly   190 VLYEHLVHQLFA 201
            :.||..|..:.:
Mouse   176 INYEAFVKHIMS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 PTZ00184 <74..196 CDD:185504 38/126 (30%)
Myl1NP_067260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PTZ00184 39..187 CDD:185504 42/140 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.