DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34435 and MYL6B

DIOPT Version :10

Sequence 1:NP_572233.2 Gene:CG34435 / 31471 FlyBaseID:FBgn0085464 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_002466.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:176 Identity:48/176 - (27%)
Similarity:79/176 - (44%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EIPKLRNIFDLFVVNECDQAAGGEDVAAPTCLDL--GIGIRMTDVADCLRIMGLNPSDDELQQRL 90
            ::.:.:..|:||     |:...|: :....|.|:  .:|...|: |:.|:::| ||..|||:.| 
Human    65 QLEEFKEAFELF-----DRVGDGK-ILYSQCGDVMRALGQNPTN-AEVLKVLG-NPKSDELKSR- 120

  Fly    91 EEHVRRRESLGMGMKKIAQRATFELVLTLYCQLAEQEVKEMAKGCIVENVLRVLRSRDSAGTGML 155
                               |..||..|.:...:|    |...:| ..|:.|...|..|..|.|.:
Human   121 -------------------RVDFETFLPMLQAVA----KNRGQG-TYEDYLEGFRVFDKEGNGKV 161

  Fly   156 PYSQLRHLLTTMGNRLDETEVYGVLHRAADINGNVLYEHLVHQLFA 201
            ..::|||:|||:|.::.|.||..||....|.||.:.||..:..:.:
Human   162 MGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34435NP_572233.2 PTZ00184 <74..196 CDD:185504 38/121 (31%)
MYL6BNP_002466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 48/174 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.