DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and PHO2

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:40/237 - (16%)
Similarity:69/237 - (29%) Gaps:86/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 HHAHHAHAQAHAHAH---AHVHAHAAHAAHAAHAHAHHAEAFLGAAGGAGGNPNSLLAAHGGDVL 379
            |.......|.|...|   ...........:..|.|..|......::..:...|            
Yeast    24 HDQQQQQQQQHDQQHNQQQQPQPQPIQTQNLEHDHDQHTNDMSASSNASDSGP------------ 76

  Fly   380 VGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQ 444
                           :|..||......|:.|::.|:....|.:..|:.:|...|:.|..:::|:|
Yeast    77 ---------------QRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQ 126

  Fly   445 NRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAE 509
            |||||.||.:.                                           |.:|.::.:::
Yeast   127 NRRAKLRKKQH-------------------------------------------GSNKDTIPSSQ 148

  Fly   510 LLKSDESDRETPTSDDTNTSYSAGSTHNSPISSFSISRLLFD 551
                         |.|....|..|||.|:.:::.|.|.:..|
Yeast   149 -------------SRDIANDYDRGSTDNNLVTTTSTSSIFHD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 17/51 (33%)
PHO2NP_010177.1 COG5576 53..183 CDD:227863 36/208 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.