DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and ATHB13

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:224 Identity:56/224 - (25%)
Similarity:84/224 - (37%) Gaps:51/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 HHAEAFLGAAG--------GAGGNPNSLLAAHGGDVLVGPGGTGPGGKKKNKRRHGRTIFTSSQL 407
            |...:|||...        ..|.|.|       |:......|:..|.||:.        ....|:
plant    45 HGFASFLGKRSPMEGCCDLETGNNMN-------GEEDYSDDGSQMGEKKRR--------LNMEQV 94

  Fly   408 EELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAM 472
            :.|||.|:..:..:...:..|:...||...:|.:|:|||||:|:         ||..|.. |..:
plant    95 KTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK---------TKQLEKD-YDTL 149

  Fly   473 VRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAEL-LKSDESDRETPTSDDTNTSYSAGSTH 536
            .|..    :|:  .|:.|      ||..|.:.|:|..: ||:.|.......:.:|.     ||..
plant   150 KRQF----DTL--KAEND------LLQTHNQKLQAEIMGLKNREQTESINLNKETE-----GSCS 197

  Fly   537 NSPISSFSISRLLFDAPPPAAGSAGGKGH 565
            |...:|....||.....||:..|....||
plant   198 NRSDNSSDNLRLDISTAPPSNDSTLTGGH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 15/51 (29%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 17/60 (28%)
HALZ 140..182 CDD:396657 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.