DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and AtHB23

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:236 Identity:54/236 - (22%)
Similarity:78/236 - (33%) Gaps:70/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 HHAEAFLGAAGGAGGNPNSLLAAHG--------------------GDVLVGPGGTGPGGKKKNKR 395
            ||.|        ...:|..|...||                    ||......|:..|.||:.  
plant    20 HHQE--------EEDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRR-- 74

  Fly   396 RHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHS 460
                  ....||:.|||.|:..:..:...:..|:...||...:|.:|:|||||:         ..
plant    75 ------LNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRAR---------SK 124

  Fly   461 TKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAEL-LKSDESDRETPTSD 524
            ||..|.. |..:.|.        .:|.:::..|    |....:.|:|..: |||.|.......:.
plant   125 TKQLEKD-YDMLKRQ--------FESLRDENEV----LQTQNQKLQAQVMALKSREPIESINLNK 176

  Fly   525 DTNTSYSAGSTHNSPISSFSISRLLFDAPPPAAGSAGGKGH 565
            :|..|.|..|.:.|.           |..||...|....||
plant   177 ETEGSCSDRSENISG-----------DIRPPEIDSQFALGH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 16/51 (31%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 18/69 (26%)
HALZ 126..168 CDD:396657 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.