DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and HB-3

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:252 Identity:63/252 - (25%)
Similarity:96/252 - (38%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LAAHGGDVLVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLA 435
            |:..|..:::|         :|.||      ....|:..|||:|:..:..:...:..|:...||.
plant   103 LSDDGSHMMLG---------EKKKR------LNLEQVRALEKSFELGNKLEPERKMQLAKALGLQ 152

  Fly   436 EDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAPWLLGM 500
            ..:|.:|:|||||:|:         ||..|...      .||.....::||..:.       |..
plant   153 PRQIAIWFQNRRARWK---------TKQLERDY------DSLKKQFDVLKSDNDS-------LLA 195

  Fly   501 HKKSLEAAELLKSDESDRETPTS---DDTNTSYS-AGST---HNSPISSFSISRLLFDAPPPAAG 558
            |.|.|. |||:...:.||:....   :....|:| .|||   ||:..|..:...::.|..|.:..
plant   196 HNKKLH-AELVALKKHDRKESAKIKREFAEASWSNNGSTENNHNNNSSDANHVSMIKDLFPSSIR 259

  Fly   559 SAGGKGHHHHHHHHKGHHHAHVHAQAQAHAHMLLHHQQQQQQQ-----QQQQQHHHH 610
            ||.......|..|.      .|..|.|...:|.....:.....     .||||||:|
plant   260 SATATTTSTHIDHQ------IVQDQDQGFCNMFNGIDETTSASYWAWPDQQQQHHNH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 15/51 (29%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 18/58 (31%)
HALZ 170..208 CDD:280364 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.