DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and HB20

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:229 Identity:51/229 - (22%)
Similarity:82/229 - (35%) Gaps:70/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 GKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKW--R 451
            |:||.:       ....|::.|||:|:..:..:...:..|:...|:...:|.:|:|||||:|  |
plant    85 GEKKKR-------LQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTR 142

  Fly   452 KTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAELLKSDES 516
            :.|:.:....|..|                    |.|.|.:.   ||..:||.|.....||:.|.
plant   143 QLERDYDSLKKQFE--------------------SLKSDNAS---LLAYNKKLLAEVMALKNKEC 184

  Fly   517 DRETPTSDDTNTSYS-AGSTHNSPISSFSISR--------LLFDAPPPAAGSAGGKGHHHHHH-- 570
            :.......:...|:| .|||.||...:..:.|        .:.|..|.:..|:.....||.:|  
plant   185 NEGNIVKREAEASWSNNGSTENSSDINLEMPRETITTHVNTIKDLFPSSIRSSAHDDDHHQNHEI 249

  Fly   571 ---------------------------HHKGHHH 577
                                       :|..|||
plant   250 VQEESLCNMFNGIDETTPAGYWAWSDPNHNHHHH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 15/53 (28%)
HB20NP_186771.1 HOX 87..140 CDD:197696 16/59 (27%)
HALZ 142..183 CDD:280364 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.