DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and vsx2

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_005158862.1 Gene:vsx2 / 796163 ZFINID:ZDB-GENE-001222-1 Length:393 Species:Danio rerio


Alignment Length:276 Identity:121/276 - (43%)
Similarity:143/276 - (51%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 AHAHAHHAEAFLGAAG-GAGGNPNSLLAAHGGDVLVGPGG------------------------- 384
            |.||...:.:.||.|| |.|          .|..|:||||                         
Zfish    71 AGAHLLASRSMLGPAGVGVG----------VGMGLIGPGGIPSFYSQPAFLEVLSDAQNVHLQPL 125

  Fly   385 ---TGP---------------------------GGKKKNKRRHGRTIFTSSQLEELEKAFKEAHY 419
               .||                           ..||:.|||| ||||||.|||||||||.||||
Zfish   126 SRTVGPLEHNQSASSDSDDVSSSERKMSKSSLSQSKKRKKRRH-RTIFTSYQLEELEKAFNEAHY 189

  Fly   420 PDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETII 484
            |||.|||:|:|||.|.|||||||:|||||||||.|||||.|:.||||||||||||||:||||:|:
Zfish   190 PDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESIL 254

  Fly   485 KSAKED--ESVAPWLL---------------------GMHKKSLEAAELLKSDESD-RETPTSDD 525
            ||||:.  :|.|||||                     ||||||||.|....:::|| .:|||:..
Zfish   255 KSAKDGIMDSCAPWLLVQDGFPTTSCFSKHEYPPFFAGMHKKSLETAGHQSNEKSDVTQTPTNPK 319

  Fly   526 TNTSYSAGSTHNSPIS 541
            .:.:.:......||:|
Zfish   320 PDEAEAEERRTESPMS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 43/51 (84%)
vsx2XP_005158862.1 Homeobox 170..221 CDD:278475 42/50 (84%)
OAR 338..355 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2566
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.