DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Vsx1

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001103016.1 Gene:Vsx1 / 689704 RGDID:1305667 Length:369 Species:Rattus norvegicus


Alignment Length:270 Identity:111/270 - (41%)
Similarity:133/270 - (49%) Gaps:67/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 LGAAGGAGGNPNSLLAAHGGDVLVG------PGGTGPG--------------------------- 388
            ||...|.|..|.|..||....:|:.      |.|..|.                           
  Rat    84 LGLLCGFGAQPPSATAARARCLLLADLRLLPPAGPEPAVAQSPVHPPPALGSQQRSENISTSDGD 148

  Fly   389 ---------------GKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDR 438
                           ||:| |||| ||:||:.|||||||||.|||||||.|||:|::||.|.|||
  Rat   149 SPSEEKNDPKMSLTLGKRK-KRRH-RTVFTAHQLEELEKAFGEAHYPDVYAREMLAVKTELPEDR 211

  Fly   439 IQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKE-DESVAPWLLGMHK 502
            ||||:|||||||||.||.||.|:.|||||||||||||.:|||::::.||.. ..|.|||||||||
  Rat   212 IQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSADSLQGSCAPWLLGMHK 276

  Fly   503 KSLEAAE---------------LLKSDESDRETPTSDDTNTSYS-AGSTHNSPISSFSISRLLFD 551
            ||.|..:               |.|..:.|.:.|.......|.: .||..:..|...|.||....
  Rat   277 KSTEMRKPESEEKLAGLWELDHLRKGAKKDEDGPERGPGKASLNPEGSLEDVAIDLSSSSRQETK 341

  Fly   552 APPPAAGSAG 561
            ..|..:.:.|
  Rat   342 KMPSGSSTQG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 40/51 (78%)
Vsx1NP_001103016.1 Homeobox 171..224 CDD:278475 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.