DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and alx3

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_005167168.1 Gene:alx3 / 566955 ZFINID:ZDB-GENE-120221-3 Length:364 Species:Danio rerio


Alignment Length:204 Identity:76/204 - (37%)
Similarity:96/204 - (47%) Gaps:57/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 KNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKC 456
            |||:|..||.|::.|||||||.|::.|||||.|||.|:::|.|.|.|:|||:|||||||||.|: 
Zfish   152 KNKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTELTEARVQVWFQNRRAKWRKRER- 215

  Fly   457 WGHSTKMAEYGLYGAM--VRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAELLKSDESDRE 519
                        ||.|  ||:..        :|..|.|:.|                :||....:
Zfish   216 ------------YGKMQEVRNHF--------AATYDISLLP----------------RSDTYQMQ 244

  Fly   520 T---PTSDDTNTSYSAGS-----THNSPISSFSISRLLFDAP----PPAAGSAGGKGHHHHHHHH 572
            .   |:......:..|.|     |.|.|.|..|    .:..|    |...|.:...|||||||||
Zfish   245 NSLWPSGAGATGAGGASSACVLGTENMPSSCMS----PYPHPHGNLPGLMGMSASPGHHHHHHHH 305

  Fly   573 KGHHHAHVH 581
              |||...|
Zfish   306 --HHHPSHH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 33/51 (65%)
alx3XP_005167168.1 Homeobox 159..211 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.