DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and alx1

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001038539.1 Gene:alx1 / 565176 ZFINID:ZDB-GENE-050419-191 Length:320 Species:Danio rerio


Alignment Length:241 Identity:80/241 - (33%)
Similarity:105/241 - (43%) Gaps:77/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 VGPGGTGPG-------GKK-------KNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSM 430
            |.|..:||.       |:|       ..|||| ||.|||:|||||||.|::.|||||..||.|:|
Zfish    92 VSPATSGPDKTDLDELGEKCDSNVSSSKKRRH-RTTFTSAQLEELEKVFQKTHYPDVYVREQLAM 155

  Fly   431 KTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAP 495
            :|.|.|.|:|||:|||||||||.|:          ||.......|.         :|..|.|:.|
Zfish   156 RTELTEARVQVWFQNRRAKWRKRER----------YGQIQQAKSHF---------AATYDISMLP 201

  Fly   496 WLLGMHKKSLEAAELLKSDESDRETPTSDDTNTSYSAGSTHNSPISSFSISRLLFDAPP------ 554
                               .:|..:..|::..|..||||   |.:||..|.|   .:||      
Zfish   202 -------------------RTDSYSQISNNLWTGPSAGS---SVVSSCMIPR---GSPPCVTSPY 241

  Fly   555 ---PAAGSAGGKGHHHHHHHHKGHHHAHVH---------AQAQAHA 588
               |.|...|..|..:|..:..|.:|..::         :.|.:||
Zfish   242 PHSPRAAEHGYVGFPNHQQNQFGVNHVSLNNFFADSLLASSANSHA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 35/51 (69%)
alx1NP_001038539.1 Homeobox 123..176 CDD:278475 36/53 (68%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 180..320 31/152 (20%)
OAR 296..313 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 300..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.