DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Awh

DIOPT Version :10

Sequence 1:NP_572232.2 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:89 Identity:32/89 - (35%)
Similarity:44/89 - (49%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LLAAH------GGDVLVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELL 428
            |..||      ||......|..| .|..|:|.:..||.||..||:.|:..|:....||....|.:
  Fly   118 LCKAHYLETVEGGTTSSDEGCDG-DGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERI 181

  Fly   429 SMKTGLAEDRIQVWYQNRRAKWRK 452
            :..|||::...|||:||.||:.:|
  Fly   182 ASVTGLSKRVTQVWFQNSRARQKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_572232.2 Homeodomain 395..452 CDD:459649 21/56 (38%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 2/4 (50%)
Homeodomain 149..205 CDD:459649 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.