DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and gsb

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:107/281 - (38%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 GAGGNPNSLLAAHGGDVLVGPGGTG-------------PGGKKKNKRRHGRTIFTSSQLEELEKA 413
            |:.|:..|    |..|.::| ||.|             |..:.|.|:|..||.|::.|::.||:.
  Fly   144 GSSGSGTS----HSIDGILG-GGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERI 203

  Fly   414 FKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRK-------------------------- 452
            |....||||..||.|:..|||.|.|:|||:.||||:.||                          
  Fly   204 FARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAPTSTSFGATPTTSAA 268

  Fly   453 ----------TEKCWGHSTKMAEYGLYGAMVRHSLPLPET----------IIKSAKEDESVAPWL 497
                      :.:.|..|.....:..||..|....|...|          :...|::..:.:.::
  Fly   269 PAPNMGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASSTSGTSSAAHSPVQTQAQQPGTGSEFM 333

  Fly   498 LGMHKKSLEAAELLKSDESDRETPTSDDTN------TSYSAGSTHNSPISSFSISRLLFDAPPPA 556
            ...:......|....:..|..:||.:....      ::.::||.|.|...|::.:...|   |||
  Fly   334 TSTYGVGSSNATYPSAAYSMPQTPATSAEQLRSQFASAAASGSHHPSTWDSYNFAGSFF---PPA 395

  Fly   557 AGSAGGKGHHHHHHHHKGHHH 577
              ||.|       :|..|:||
  Fly   396 --SAAG-------NHISGYHH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 26/51 (51%)
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 28/56 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450958
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.