| Sequence 1: | NP_001284898.1 | Gene: | Vsx1 / 31470 | FlyBaseID: | FBgn0263511 | Length: | 837 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_878314.1 | Gene: | VSX2 / 338917 | HGNCID: | 1975 | Length: | 361 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 118/236 - (50%) |
|---|---|---|---|
| Similarity: | 134/236 - (56%) | Gaps: | 73/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 350 AHHAEAFLGAAGGAGGNPNSLLAAH--------GGDVLVGPGG---------------------- 384
Fly 385 ------TGP---------------------------GGKKKNKRRHGRTIFTSSQLEELEKAFKE 416
Fly 417 AHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPE 481
Fly 482 TIIKSAKED--ESVAPWLLGMHKKSLE-AAELLKSDESDRE 519 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Vsx1 | NP_001284898.1 | Homeobox | 399..451 | CDD:278475 | 43/51 (84%) |
| VSX2 | NP_878314.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 104..151 | 6/46 (13%) | |||
| Homeobox | 153..205 | CDD:395001 | 43/51 (84%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..300 | 5/14 (36%) | |||
| OAR | 300..318 | CDD:397759 | |||
| OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 304..317 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 313..361 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0494 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0002963 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR46892 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2566 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 5.900 | |||||