DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and arxa

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:147 Identity:62/147 - (42%)
Similarity:76/147 - (51%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 AAGGAGGNPNSLLAAHG-GDVLVG-------PGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFK 415
            |.|....:|....:.|. |||..|       .|.....|..|.|:|..||.|||.||||||:||:
Zfish   171 ACGDNSLSPKDEESLHNDGDVKDGEDSVCLSAGSDSEEGMLKRKQRRYRTTFTSYQLEELERAFQ 235

  Fly   416 EAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKC--WGHSTKMAEYGLYGAM--VRHS 476
            :.|||||..||.|:|:..|.|.|:|||:|||||||||.||.  ..|.|.:...|...|.  :.|.
Zfish   236 KTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGVQAHPTGLPFPGPLAAAHPLSHY 300

  Fly   477 L------PLPETIIKSA 487
            |      |.|...::||
Zfish   301 LEGGPFPPHPHPALESA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 34/51 (67%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212 10/40 (25%)
Homeobox 219..271 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418
OAR 417..434 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.