DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and rx1

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_571300.2 Gene:rx1 / 30472 ZFINID:ZDB-GENE-990415-236 Length:330 Species:Danio rerio


Alignment Length:147 Identity:52/147 - (35%)
Similarity:75/147 - (51%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 HHAEAFLGAAGGAGGNPNSLLAAHGGDVLVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFK 415
            |.|:.|.....|..|:....:.:....     ..:..|.:.|.|.|..||.||:.||.|||:||:
Zfish    98 HDADMFSNKCDGDLGDLRKAIESDSKS-----PDSADGEQPKKKHRRNRTTFTTYQLHELERAFE 157

  Fly   416 EAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLP 480
            ::|||||.:||.|:||..|.|.|:|||:||||||||:.||....:.|:.:    ..|:..:.|..
Zfish   158 KSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDASTMKLHD----SPMLSFNRPSM 218

  Fly   481 ETIIKSAKEDESVAPWL 497
            ...:........:.|||
Zfish   219 HPTVGPMNNSLPLDPWL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 33/51 (65%)
rx1NP_571300.2 Octapeptide motif 37..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..104 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 4/28 (14%)
Homeobox 141..193 CDD:278475 33/51 (65%)
OAR 302..318 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Nuclear localization signal. /evidence=ECO:0000255 312..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.