DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Alx4

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 / 296511 RGDID:1310201 Length:399 Species:Rattus norvegicus


Alignment Length:289 Identity:86/289 - (29%)
Similarity:111/289 - (38%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 YASSLANASGDEQSP---SKNSSSSGNGGSGGSGSGSGGGNPTSNGLGHLGSPTASNGGSGGGAG 252
            |..|.|.|.....||   |:..||...|..||...|:             ...:|:..|.|.|..
  Rat     9 YCESPATAMDAYYSPVSQSREGSSPFRGFPGGDKFGT-------------TFLSAAAKGQGFGDA 60

  Fly   253 VGGSGGGSGTSGSNSSTSGNGGNGGS----SGSRSSPAGPHHSAALAAHQHAAAAAAAAHHHAA- 312
            .|.:..|:|.....:....|.|..||    .....:|..|....|..||.:....|.......: 
  Rat    61 KGRARYGAGQQDLAAPLESNAGARGSFNKFQPQPPTPQPPPAPPAPPAHLYLQRGACKTPPDGSL 125

  Fly   313 AAAAAHHAHHAHAQAHAHAHAHVHAHAAHAAHAAHAHAHHAEAFLGAAGGAGGNPNSLLAAHGGD 377
            ........|:|..|...:|                ..::..|..|.......|..||.|:     
  Rat   126 KLQEGSGGHNAALQVPCYA----------------KESNLGEPELPPDSEPVGMDNSYLS----- 169

  Fly   378 VLVGPGGTGPGGK----------------KKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARE 426
             :...|..||..:                .|.|:|..||.|||.|||||||.|::.|||||.|||
  Rat   170 -VKETGAKGPQDRAGAEIPSPLEKTDSESSKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYARE 233

  Fly   427 LLSMKTGLAEDRIQVWYQNRRAKWRKTEK 455
            .|:|:|.|.|.|:|||:|||||||||.|:
  Rat   234 QLAMRTDLTEARVQVWFQNRRAKWRKRER 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 36/51 (71%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 36/51 (71%)
OAR 375..392 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.