DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and ALX3

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:233 Identity:74/233 - (31%)
Similarity:96/233 - (41%) Gaps:37/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 SRSSPAGPHHSAALAAHQHAA--AAAAAAHHHAAAAAAAHHAHHAHAQAH---------AHAHAH 334
            |...|.||..:.|.|.|.|.|  .........|......:....|...|.         |....|
Human    21 SGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPYLPEPAKPPAKYLQDLGPGPALNGGH 85

  Fly   335 VHAHAAHAAHAAHAHAHHAEAFLGAAGGAGGNPNSLLAAHGGDVLVGPGGTGPG-------GKKK 392
            .:...|.|.......|...:..|...||....|::|..:.|..:........||       .|.|
Human    86 FYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNK 150

  Fly   393 NKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCW 457
            :|:|..||.|::.|||||||.|::.|||||.|||.|:::|.|.|.|:|||:|||||||||.|:  
Human   151 SKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRER-- 213

  Fly   458 GHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAP 495
                       ||.:.....|.      :|..|.||.|
Human   214 -----------YGKIQEGRNPF------TAAYDISVLP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 33/51 (65%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 17/82 (21%)
PRK12323 <13..131 CDD:237057 23/109 (21%)
Homeobox 157..210 CDD:365835 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.