DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Alx1

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:188 Identity:69/188 - (36%)
Similarity:89/188 - (47%) Gaps:47/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 KRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWG 458
            |||| ||.|||.|||||||.|::.|||||..||.|:::|.|.|.|:|||:|||||||||.|:   
  Rat   132 KRRH-RTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRER--- 192

  Fly   459 HSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAP------------WLLGMHKKSLEAAELL 511
                   ||.......|.         :|..|.||.|            |.......|:..:.:|
  Rat   193 -------YGQIQQAKSHF---------AATYDISVLPRTDSYPQIQNNLWAGNTSGGSVVTSCML 241

  Fly   512 KSDESDRETPTSDD--TNTSYSAGSTHNS-----PISSFSISRLL--------FDAPP 554
            ..|.|...||.|..  |::||:..|.|.:     |:::|....||        |:..|
  Rat   242 PRDASSCMTPYSHSPRTDSSYTGFSNHQNQFGHVPLNNFFTDSLLTGTTNGHAFETKP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 34/51 (67%)
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 35/53 (66%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 27/127 (21%)
OAR 302..319 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.