DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Prrx2

DIOPT Version :10

Sequence 1:NP_572232.2 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_006497869.1 Gene:Prrx2 / 20204 MGIID:98218 Length:259 Species:Mus musculus


Alignment Length:66 Identity:18/66 - (27%)
Similarity:28/66 - (42%) Gaps:13/66 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 WGGLLIIHSMQYREALQQRRQEAVATAAIEALTKDSILH--RRDVKTLV---------KSHKKSK 219
            |..|..|....|||.:.:..|. :||...: |.|.|::.  .|.|:..|         :.|.|:|
Mouse   117 WTSLDPIQRTLYREVMLENYQN-LATVGGQ-LFKPSLISWLERKVELTVMEQGILQEWEMHLKTK 179

  Fly   220 K 220
            :
Mouse   180 R 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_572232.2 Homeodomain 395..452 CDD:459649
Prrx2XP_006497869.1 Homeodomain 103..167 CDD:459649 15/51 (29%)
OAR 233..249 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.