DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Otp

DIOPT Version :10

Sequence 1:NP_572232.2 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_035151.1 Gene:Otp / 18420 MGIID:99835 Length:325 Species:Mus musculus


Alignment Length:100 Identity:48/100 - (48%)
Similarity:64/100 - (64%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 GGNPNSL-LAAHGGDVLVGP-GGTGPG------GKKKNKRRHGRTIFTSSQLEELEKAFKEAHYP 420
            |..|.|| ::|...|...|| ||..|.      |::|.||.  ||.||.:||.|||::|.:.|||
Mouse    67 GSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRH--RTRFTPAQLNELERSFAKTHYP 129

  Fly   421 DVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEK 455
            |:..||.|:::.||.|.|:|||:|||||||:|.:|
Mouse   130 DIFMREELALRIGLTESRVQVWFQNRRAKWKKRKK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_572232.2 Homeodomain 395..452 CDD:459649 32/56 (57%)
OtpNP_035151.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 17/46 (37%)
Homeodomain 106..156 CDD:459649 27/51 (53%)
OAR 303..320 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.