Sequence 1: | NP_001284898.1 | Gene: | Vsx1 / 31470 | FlyBaseID: | FBgn0263511 | Length: | 837 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017449515.1 | Gene: | Vsx2 / 171360 | RGDID: | 621215 | Length: | 380 | Species: | Rattus norvegicus |
Alignment Length: | 271 | Identity: | 119/271 - (43%) |
---|---|---|---|
Similarity: | 135/271 - (49%) | Gaps: | 103/271 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 350 AHHAEAFLGAAGGAGGNPNSLLAAH--------GGDVLVGPGG---------------------- 384
Fly 385 ------TGP---------------------------GGKKKNKRRHGRTIFTSSQLEELEKAFKE 416
Fly 417 AHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHSLPLPE 481
Fly 482 TIIKSAKED--ESVAPWL-------------------LGMHKKSLEAAE------------LLKS 513
Fly 514 DESDRETPTSD 524 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vsx1 | NP_001284898.1 | Homeobox | 399..451 | CDD:278475 | 43/51 (84%) |
Vsx2 | XP_017449515.1 | Homeobox | 153..205 | CDD:395001 | 43/51 (84%) |
OAR | 319..337 | CDD:397759 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0494 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002963 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR46892 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
5 | 4.870 |