DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Phox2a

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_032913.1 Gene:Phox2a / 11859 MGIID:106633 Length:280 Species:Mus musculus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:93/261 - (35%) Gaps:105/261 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PGG-KKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKW 450
            |.| .:|.|:|..||.|||:||:|||:.|.|.||||:..||.|::|..|.|.|:|||:||||||:
Mouse    81 PSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKF 145

  Fly   451 RKTEKCWGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAELLKSDE 515
            ||.|:  ..|.|    |..||             ..||:.|                |.....|:
Mouse   146 RKQER--AASAK----GAAGA-------------TGAKKGE----------------ARCSSEDD 175

  Fly   516 SDRE---TPTSDDTNTSYSAGSTHNSPISSFSISRLLFDAPPPAAGSAGGKGHHHHHHHHKGHHH 577
            ..:|   :||.|.|      .|....|..|.:..||.....|.|.||..|               
Mouse   176 DSKESTCSPTPDST------ASLPPPPAPSLASPRLSPSPLPAALGSGPG--------------- 219

  Fly   578 AHVHAQAQAHAHMLLHHQQQQQQQQQQQQHHHHLHAAENSLQQQQVAG---TGSGSGSGSGSGTG 639
                                                      .|.:.|   .|...|.|.|.|||
Mouse   220 ------------------------------------------PQPLKGALWAGVAGGGGGGPGTG 242

  Fly   640 A 640
            |
Mouse   243 A 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 32/51 (63%)
Phox2aNP_032913.1 Homeobox 94..147 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..244 38/197 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.