DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and Alx3

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:169 Identity:62/169 - (36%)
Similarity:85/169 - (50%) Gaps:26/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 HVHAHAAHAAHAAHAHAHHAEAFLGAAGGAGGNPNSLLAAHGG-----DVLVGPG--GTGPGGKK 391
            |.:..:|.|...|...|...:..:...||....|:::.|:.|.     .|.:.||  .:....|.
Mouse    85 HFYEGSAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGLPDSMELAKT 149

  Fly   392 KNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKC 456
            |:|:|..||.|::.|||||||.|::.|||||.|||.|:::|.|.|.|:|||:|||||||||.|: 
Mouse   150 KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRER- 213

  Fly   457 WGHSTKMAEYGLYGAMVRHSLPLPETIIKSAKEDESVAP 495
                        ||.|.....|.      :...|.||.|
Mouse   214 ------------YGKMQEGRNPF------TTAYDISVLP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 33/51 (65%)
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 8/36 (22%)
SP2 32..>141 CDD:281067 13/55 (24%)
Homeobox 157..209 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.