DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and arx

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:216 Identity:73/216 - (33%)
Similarity:90/216 - (41%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 GAAGGAGGNPNSLLAAHGGD---------VLVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKA 413
            |....|..:|...|..|..|         |.:..|.....|..|.|:|..||.|||.||||||:|
 Frog   255 GCGTDAELSPKEELMLHSSDADGKDGEDSVCLSAGSDSEEGMLKRKQRRYRTTFTSYQLEELERA 319

  Fly   414 FKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVRHS-- 476
            |::.|||||..||.|:|:..|.|.|:|||:|||||||||.||.             ||.. |:  
 Frog   320 FQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKA-------------GAQT-HAPG 370

  Fly   477 LPLPETIIKSAKEDESVAPWLLGMHKKSLEAAELLKSDES--DRETPTSDDTNTSYSAGSTHNSP 539
            ||.|..:..|    ..:.|:|                |.|  ....|..|...|:.:|.:....|
 Frog   371 LPFPGPLSAS----HPLGPYL----------------DASPFPPHHPALDSAWTAAAAAAAAAFP 415

  Fly   540 ISSFSISRLLFDAPPPAAGSA 560
                       ..|||..|||
 Frog   416 -----------SLPPPPHGSA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 34/51 (67%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 35/52 (67%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.