DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and phox2a

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001239128.1 Gene:phox2a / 100486496 XenbaseID:XB-GENE-853857 Length:281 Species:Xenopus tropicalis


Alignment Length:230 Identity:78/230 - (33%)
Similarity:104/230 - (45%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 GGAGGNP--------NSLLAAHGGDVLVGPGGTGP--------GGKKKNKRRHGRTIFTSSQLEE 409
            |..|.||        |..|.|. .|....|..|.|        |..:|.|:|..||.||||||:|
 Frog    43 GSFGANPACPPLTTANCTLGAL-RDHQPSPYSTVPYKFFSDPSGINEKRKQRRIRTTFTSSQLKE 106

  Fly   410 LEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWGHSTKMAEYGLYGAMVR 474
            ||:.|.|.||||:..||.|::|..|.|.|:|||:||||||:||.|:.....:..:..|  |:..:
 Frog   107 LERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAANSKSGSSNNG--GSGNK 169

  Fly   475 HSLPLPETIIKSAKEDESVAPWLLGMHKKSLEAAELLKSDESDRETPTSDDTNTSYSAGSTHNSP 539
            .|.|      :|:.||:                    :|.||:. :||.|.|.:..:||:. |||
 Frog   170 KSDP------RSSSEDD--------------------ESKESNC-SPTPDSTASLPTAGNL-NSP 206

  Fly   540 ISSFSISRLLFDAPPPAAGSAGGKGHHHHHHHHKG 574
            ..|.|          |:.|:..|....|.....||
 Frog   207 GGSLS----------PSPGAVSGLVSAHTVQALKG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 33/51 (65%)
phox2aNP_001239128.1 Homeobox 96..148 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.