DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx1 and alx4a

DIOPT Version :9

Sequence 1:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:217 Identity:69/217 - (31%)
Similarity:90/217 - (41%) Gaps:85/217 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 LVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWY 443
            |..|.....|...|.|:|..||.|||.|||||||.|::.|||||.|||.|:::|.|.|.|:|||:
Zfish   159 LASPLDKTEGESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWF 223

  Fly   444 QNRRAKWRKTEKCWGHSTKMAEYGLYGAM--VR------HSLPL---PETIIKSAKEDESVAPWL 497
            |||||||||.|:             :|.|  ||      :.|||   ||..              
Zfish   224 QNRRAKWRKRER-------------FGQMQQVRTHFSTAYELPLLTRPENY-------------- 261

  Fly   498 LGMHKKSLEAAELLKSDESDRETPTSDDTNTSYSAGSTHNSPISSF-----SISRLLFDAPP--- 554
                      |::               .|.|:..||:..||:...     |::..:   ||   
Zfish   262 ----------AQI---------------QNPSWIGGSSAASPVPGCVVPCDSVTSCM---PPHPH 298

  Fly   555 -----------PAAGSAGGKGH 565
                       |:.||..|:.|
Zfish   299 AASGVSDFLGVPSPGSHMGQTH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 35/51 (69%)
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 35/51 (69%)
OAR 344..361 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.