Sequence 1: | NP_001284898.1 | Gene: | Vsx1 / 31470 | FlyBaseID: | FBgn0263511 | Length: | 837 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001340966.1 | Gene: | alx4a / 100006399 | ZFINID: | ZDB-GENE-070712-3 | Length: | 368 | Species: | Danio rerio |
Alignment Length: | 217 | Identity: | 69/217 - (31%) |
---|---|---|---|
Similarity: | 90/217 - (41%) | Gaps: | 85/217 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 379 LVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWY 443
Fly 444 QNRRAKWRKTEKCWGHSTKMAEYGLYGAM--VR------HSLPL---PETIIKSAKEDESVAPWL 497
Fly 498 LGMHKKSLEAAELLKSDESDRETPTSDDTNTSYSAGSTHNSPISSF-----SISRLLFDAPP--- 554
Fly 555 -----------PAAGSAGGKGH 565 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vsx1 | NP_001284898.1 | Homeobox | 399..451 | CDD:278475 | 35/51 (69%) |
alx4a | XP_001340966.1 | Homeobox | 179..231 | CDD:278475 | 35/51 (69%) |
OAR | 344..361 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.870 |