DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and LHX4

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:250 Identity:63/250 - (25%)
Similarity:87/250 - (34%) Gaps:84/250 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGS 295
            :..||..|:.|||.|:.|:|.:..|..:.||.||.:|.|....:||||||||||.::.:|..|  
Human   158 KRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAG-- 220

  Fly   296 TIMAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHR---KSIEAQSALKDDSGV 357
                         ||.                   |  |...|.:.|   .|.:.:.:..:|.||
Human   221 -------------RHR-------------------W--GQFYKSVKRSRGSSKQEKESSAEDCGV 251

  Fly   358 SD-----HEDSAGSKSAHS-----------------------------EDLSRSRCHALSSSTES 388
            ||     .||...|:..|:                             :||.....:.:..|..|
Human   252 SDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGSPYGIPQSPSS 316

  Fly   389 LNVVSPAPSSCPTSASTSAPPTSTSG---YAGAASS-----AATTPTGASTTNSS 435
               :|..||..|..........|..|   :||...|     .|..||...:|.||
Human   317 ---ISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 26/52 (50%)
OAR 556..570 CDD:281777
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852
LIM2_Lhx3_Lhx4 89..144 CDD:188762
Homeobox 160..213 CDD:306543 26/52 (50%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 9/19 (47%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 8/11 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174754at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.