Sequence 1: | NP_001284897.1 | Gene: | Vsx2 / 31469 | FlyBaseID: | FBgn0263512 | Length: | 645 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_203129.1 | Gene: | LHX4 / 89884 | HGNCID: | 21734 | Length: | 390 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 63/250 - (25%) |
---|---|---|---|
Similarity: | 87/250 - (34%) | Gaps: | 84/250 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 RHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGS 295
Fly 296 TIMAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHR---KSIEAQSALKDDSGV 357
Fly 358 SD-----HEDSAGSKSAHS-----------------------------EDLSRSRCHALSSSTES 388
Fly 389 LNVVSPAPSSCPTSASTSAPPTSTSG---YAGAASS-----AATTPTGASTTNSS 435 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Vsx2 | NP_001284897.1 | Homeobox | 233..286 | CDD:278475 | 26/52 (50%) |
OAR | 556..570 | CDD:281777 | |||
LHX4 | NP_203129.1 | LIM1_Lhx4 | 30..81 | CDD:188852 | |
LIM2_Lhx3_Lhx4 | 89..144 | CDD:188762 | |||
Homeobox | 160..213 | CDD:306543 | 26/52 (50%) | ||
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 | 161..181 | 9/19 (47%) | |||
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 | 199..211 | 8/11 (73%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 230..253 | 5/22 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 356..390 | 5/12 (42%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1174754at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |