DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and PHOX2B

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens


Alignment Length:351 Identity:99/351 - (28%)
Similarity:119/351 - (33%) Gaps:145/351 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 AQGF---PQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGP------------NSKKKKKKRRH 232
            |.||   |...:|.|.:| |  .||.|....:.:|......|            ....:|:|:|.
Human    39 ASGFQYNPIRTTFGATSG-C--PSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRR 100

  Fly   233 SRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEKVWGGSTI 297
            .||.|||.||::||..|.|.||||:|.||.|:||.:|.|.|:||||||||||:||.|:....:..
Human   101 IRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAA 165

  Fly   298 MAEYGLYGAMVRHSLPLPDTILKSAKDNDAVAPWLLGMEQKCMHRKSIEAQSALKDDSGVSDHED 362
            .|:.|                                             .|..|.||...|.  
Human   166 AAKNG---------------------------------------------SSGKKSDSSRDDE-- 183

  Fly   363 SAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAPSSCPTSASTSAPPTSTSGYAGAASSAATTPT 427
               ||.|.|.|         ..||.     .|.|:..||      |....:|..|          
Human   184 ---SKEAKSTD---------PDSTG-----GPGPNPNPT------PSCGANGGGG---------- 215

  Fly   428 GASTTNSSSSPHIELGSPSPQQQQHLQLQQQQQQQASLYLGAGAV-VTGCAPPSYHPLLDAANAA 491
                           |.|||                     |||. ..|...|...|....|.||
Human   216 ---------------GGPSP---------------------AGAPGAAGPGGPGGEPGKGGAAAA 244

  Fly   492 GAGAAASSKDFHMIMNTAVAAAAAAA 517
            .|.|||:          |.|||||||
Human   245 AAAAAAA----------AAAAAAAAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 34/52 (65%)
OAR 556..570 CDD:281777
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 34/52 (65%)
polyalanine repeat 241..260 13/28 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.