DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and RAX2

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001306003.2 Gene:RAX2 / 84839 HGNCID:18286 Length:184 Species:Homo sapiens


Alignment Length:121 Identity:57/121 - (47%)
Similarity:74/121 - (61%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GFGVGPNSKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQN 280
            |.|:||..:..|||.|.:||.||:|||.:||.||:.:||||||:||.|:.|..|||.|:||||||
Human    13 GGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQN 77

  Fly   281 RRAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLP----LPDTILKSAKDNDAVAPWL 332
            ||||||:.|::..||         ||:....||    ||  ..:....:..:.|||
Human    78 RRAKWRRQERLESGS---------GAVAAPRLPEAPALP--FARPPAMSLPLEPWL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 35/52 (67%)
OAR 556..570 CDD:281777
RAX2NP_001306003.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 9/19 (47%)
Homeobox 31..84 CDD:395001 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.