DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsx2 and Vsx1

DIOPT Version :9

Sequence 1:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001103016.1 Gene:Vsx1 / 689704 RGDID:1305667 Length:369 Species:Rattus norvegicus


Alignment Length:272 Identity:117/272 - (43%)
Similarity:141/272 - (51%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PPPPPPMQHHHPHHPHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKK- 225
            |..|.|.....|.||                        |.:|..:..........|..|:.:| 
  Rat   115 PAGPEPAVAQSPVHP------------------------PPALGSQQRSENISTSDGDSPSEEKN 155

  Fly   226 ---------KKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNR 281
                     |:||||| ||:||::|||:||:||.|||||||||||||::||||||||||||||||
  Rat   156 DPKMSLTLGKRKKRRH-RTVFTAHQLEELEKAFGEAHYPDVYAREMLAVKTELPEDRIQVWFQNR 219

  Fly   282 RAKWRKTEKVWGGSTIMAEYGLYGAMVRHSLPLPDTILKSAKD-NDAVAPWLLGMEQKCMHRKSI 345
            ||||||.||.||||::|||||||||||||.:||||::|.||.. ..:.|||||||.:|....:..
  Rat   220 RAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSADSLQGSCAPWLLGMHKKSTEMRKP 284

  Fly   346 EAQSAL--------------KDDSGVSDHEDSAGSKSAHSEDLSRSRCHALSSSTESLNVVSPAP 396
            |::..|              ||:.|   .|...|..|.:.|.........||||  |.......|
  Rat   285 ESEEKLAGLWELDHLRKGAKKDEDG---PERGPGKASLNPEGSLEDVAIDLSSS--SRQETKKMP 344

  Fly   397 SSCPTSASTSAP 408
            |...|...|.||
  Rat   345 SGSSTQGCTHAP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 43/52 (83%)
OAR 556..570 CDD:281777
Vsx1NP_001103016.1 Homeobox 171..224 CDD:278475 44/53 (83%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6220
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002963
OrthoInspector 1 1.000 - - otm45313
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.